RGS5 antibody (Middle Region)

Catalog No. ABIN632273

Product Details anti-RGS5 Antibody

Target: RGS5 (Regulator of G-Protein Signaling 5 (RGS5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RGS5 antibody was raised against the middle region of RGS5

Purification: Affinity purified

Immunogen: RGS5 antibody was raised using the middle region of RGS5 corresponding to a region with amino acids PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS5 Blocking Peptide, catalog no. 33R-7114, is also available for use as a blocking control in assays to test for specificity of this RGS5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS5

Target: RGS5 (Regulator of G-Protein Signaling 5 (RGS5))

Alternative Name: RGS5 (RGS5 Products)

Synonyms: MST092 antibody, MST106 antibody, MST129 antibody, MSTP032 antibody, MSTP092 antibody, MSTP106 antibody, MSTP129 antibody, RGS5 antibody, 1110070A02Rik antibody, fj30h05 antibody, rgs5 antibody, wu:fj30h05 antibody, zgc:64006 antibody, xrgs5 antibody, MGC147439 antibody, zgc:110206 antibody, regulator of G protein signaling 5 antibody, regulator of G-protein signaling 5 antibody, regulator of G protein signaling 5a antibody, regulator of G-protein signaling 5 L homeolog antibody, regulator of G protein signaling 5b antibody, RGS5 antibody, Rgs5 antibody, rgs5a antibody, rgs5 antibody, rgs5.L antibody, rgs5b antibody

Background: The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling