SAMD4A antibody (Middle Region)
-
- Target See all SAMD4A Antibodies
- SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SAMD4A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SAMD4 A antibody was raised against the middle region of SAMD4
- Purification
- Affinity purified
- Immunogen
- SAMD4 A antibody was raised using the middle region of SAMD4 corresponding to a region with amino acids LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK
- Top Product
- Discover our top product SAMD4A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SAMD4A Blocking Peptide, catalog no. 33R-5106, is also available for use as a blocking control in assays to test for specificity of this SAMD4A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))
- Alternative Name
- SAMD4A (SAMD4A Products)
- Synonyms
- SAMD4 antibody, SMAUG antibody, SMAUG1 antibody, SMG antibody, SMGA antibody, Samd4 antibody, smaug1 antibody, sterile alpha motif domain containing 4A antibody, sterile alpha motif domain containing 4A S homeolog antibody, SAMD4A antibody, Samd4a antibody, samd4a.S antibody, samd4a antibody
- Background
- Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.
- Molecular Weight
- 79 kDa (MW of target protein)
-