PDHB antibody

Catalog No. ABIN632317

Product Details anti-PDHB Antibody

Target: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDHB antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDHB Blocking Peptide, catalog no. 33R-3431, is also available for use as a blocking control in assays to test for specificity of this PDHB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDHB

Target: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Alternative Name: PDHB (PDHB Products)

Synonyms: CG 11876 antibody, Dmel\\CG11876 antibody, E1beta antibody, PDHB antibody, zgc:64062 antibody, wu:fc76a05 antibody, PDHBD antibody, PDHE1-B antibody, PHE1B antibody, 2610103L06Rik antibody, AL024199 antibody, C81408 antibody, CG11876 gene product from transcript CG11876-RA antibody, pyruvate dehydrogenase E1 beta subunit antibody, pyruvate dehydrogenase (lipoamide) beta antibody, CG11876 antibody, pdhb antibody, PDHB antibody, Pdhb antibody

Background: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Warburg Effect