Serotonin Receptor 2B antibody

Catalog No. ABIN632341

This Rabbit Polyclonal antibody specifically detects Serotonin Receptor 2B in WB. It exhibits reactivity toward Human.

Quick Overview for Serotonin Receptor 2B antibody (ABIN632341)

Target: Serotonin Receptor 2B (HTR2B)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Serotonin Receptor 2B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Serotonin Receptor 2B Antibody

Purification: Affinity purified

Immunogen: Serotonin receptor 2 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Serotonin receptor 2B Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Serotonin Receptor 2B

Target: Serotonin Receptor 2B (HTR2B)

Alternative Name: Serotonin Receptor 2B

Background: Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognised. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets, central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Carbohydrate Metabolic Process