ARL17 antibody (Middle Region)

Catalog No. ABIN632378

Product Details anti-ARL17 Antibody

Target: ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARL17 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARL17 antibody was raised against the middle region of ARL17

Purification: Affinity purified

Immunogen: ARL17 antibody was raised using the middle region of ARL17 corresponding to a region with amino acids KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL17 Blocking Peptide, catalog no. 33R-4276, is also available for use as a blocking control in assays to test for specificity of this ARL17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARL17

Target: ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))

Alternative Name: ARL17 (ARL17 Products)

Synonyms: ARL17 antibody, ARL17A antibody, ADP ribosylation factor like GTPase 17B antibody, ARL17B antibody

Background: ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus.

Molecular Weight: 19 kDa (MW of target protein)