SLC12A1 antibody

Catalog No. ABIN632379

The Rabbit Polyclonal anti-SLC12A1 antibody (ABIN632379) specifically detects SLC12A1 in WB and IHC. The antibody is reactive with Human, Rat, Mouse and Dog samples.

Quick Overview for SLC12A1 antibody (ABIN632379)

Target: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC12A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC12A1 Antibody

Purification: Affinity purified

Immunogen: SLC12 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC12A1 Blocking Peptide, (ABIN5616175), is also available for use as a blocking control in assays to test for specificity of this SLC12A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC12A1

Target: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Alternative Name: SLC12A1

Background: The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

Molecular Weight: 47 kDa (MW of target protein)