AP3S1 antibody (N-Term)

Catalog No. ABIN632399

Product Details anti-AP3S1 Antibody

Target: AP3S1 (Adaptor-Related Protein Complex 3, sigma 1 Subunit (AP3S1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AP3S1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AP3 S1 antibody was raised against the N terminal of AP3 1

Purification: Affinity purified

Immunogen: AP3 S1 antibody was raised using the N terminal of AP3 1 corresponding to a region with amino acids IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AP3S1 Blocking Peptide, catalog no. 33R-4012, is also available for use as a blocking control in assays to test for specificity of this AP3S1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AP3S1

Target: AP3S1 (Adaptor-Related Protein Complex 3, sigma 1 Subunit (AP3S1))

Alternative Name: AP3S1 (AP3S1 Products)

Synonyms: CLAPS3 antibody, Sigma3A antibody, [s]3A antibody, adaptor related protein complex 3 sigma 1 subunit antibody, adaptor-related protein complex 3, sigma 1 subunit antibody, adaptor related protein complex 3 sigma 1 subunit S homeolog antibody, AP3S1 antibody, Ap3s1 antibody, ap3s1.S antibody

Background: AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Molecular Weight: 22 kDa (MW of target protein)