COPG2 antibody (N-Term)

Catalog No. ABIN632404

Product Details anti-COPG2 Antibody

Target: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COPG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: COPG2 antibody was raised against the N terminal of COPG2

Purification: Affinity purified

Immunogen: COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COPG2 Blocking Peptide, catalog no. 33R-6111, is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COPG2

Target: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Alternative Name: COPG2 (COPG2 Products)

Synonyms: 2-COP antibody, cb943 antibody, copg antibody, fi31b06 antibody, wu:fi31b06 antibody, AW227625 antibody, gamma-2-COP antibody, COPG antibody, COPG2 antibody, MGC83366 antibody, MGC79509 antibody, RGD1566215 antibody, coatomer protein complex subunit gamma 2 antibody, coatomer protein complex, subunit gamma 2 antibody, coatomer protein complex subunit gamma 1 antibody, coatomer protein complex subunit gamma 2 S homeolog antibody, coatomer subunit gamma-2 antibody, COPG2 antibody, copg2 antibody, Copg2 antibody, COPG1 antibody, copg2.S antibody, LOC100068740 antibody, LOC100560095 antibody, LOC100594709 antibody

Background: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Molecular Weight: 97 kDa (MW of target protein)