VTA1 antibody

Catalog No. ABIN632410

Product Details anti-VTA1 Antibody

Target: VTA1 (Vps20-Associated 1 Homolog (VTA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VTA1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VTA1 Blocking Peptide, catalog no. 33R-4488, is also available for use as a blocking control in assays to test for specificity of this VTA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VTA1

Target: VTA1 (Vps20-Associated 1 Homolog (VTA1))

Alternative Name: VTA1 (VTA1 Products)

Synonyms: C6orf55 antibody, DRG-1 antibody, DRG1 antibody, LIP5 antibody, My012 antibody, SBP1 antibody, 1110001D18Rik antibody, 1110059P08Rik antibody, AU040813 antibody, C85340 antibody, Lip5 antibody, RGD1305031 antibody, Vps20-associated 1 homolog antibody, vesicle trafficking 1 antibody, vesicle (multivesicular body) trafficking 1 antibody, Vta1 antibody, VTA1 antibody

Background: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.

Molecular Weight: 34 kDa (MW of target protein)