C1orf116 antibody (Middle Region)

Catalog No. ABIN632417

Product Details anti-C1orf116 Antibody

Target: C1orf116 (c1orf116) (Chromosome 1 Open Reading Frame 116 (c1orf116))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf116 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C1 ORF116 antibody was raised against the middle region of C1 rf116

Purification: Affinity purified

Immunogen: C1 ORF116 antibody was raised using the middle region of C1 rf116 corresponding to a region with amino acids SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1ORF116 Blocking Peptide, catalog no. 33R-8474, is also available for use as a blocking control in assays to test for specificity of this C1ORF116 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF116 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf116

Target: C1orf116 (c1orf116) (Chromosome 1 Open Reading Frame 116 (c1orf116))

Alternative Name: C1ORF116 (c1orf116 Products)

Synonyms: SARG antibody, C26H1orf116 antibody, E030025M07 antibody, Sarg antibody, chromosome 1 open reading frame 116 antibody, chromosome 16 open reading frame, human C1orf116 antibody, chromosome 26 C1orf116 homolog antibody, expressed sequence AA986860 antibody, similar to specifically androgen-regulated protein antibody, c1orf116 antibody, C1orf116 antibody, C16H1orf116 antibody, C26H1orf116 antibody, AA986860 antibody, LOC498222 antibody

Background: C1orf116 belongs to the SARG family. It is a putative androgen-specific receptor. It is highly expressed in prostate.

Molecular Weight: 37 kDa (MW of target protein)