Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Lactate Dehydrogenase A (LDHA) antibody
| Antigen | Lactate Dehydrogenase A (LDHA) |
| Synonyms | LDH1, LDHM, GSD11, PIG19, LDHA, LDH-M, Ldh1, Ldhm, l7R2, ldhbb, ldha-B, MGC83980, ldh1, ldhm, gsd11, ldh-m, pig19, MGC53139, MGC76171, MGC90004, ldha1, ldhab, LDH-A, LDHC, DKFZp469J2231 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Application |
Alternatives Western Blotting (WB)
|
| Catalog no. | ABIN632424 |
| Quantity | 50 ug (1 mg/ml) (Variants) |
| Price | 478.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Alternative name | LDHA |
| Immunogen | LDHA antibody was raised using the middle region of LDHA corresponding to a region with amino acids PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH |
| Description | LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. |
| Molecular Weight | 37 kDa (MW of target protein) |
Application Details
| Concentration | 1 mg/ml |
| Purification | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LDHA antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Research Area | Cancer, Metabolism, Enzymes |
| Restrictions | For Research Use only |
Alternatives
Alternatives for antigen "Lactate Dehydrogenase A (LDHA)", type "Antibodies"
| Hosts | Mouse (20), Rabbit (19), Goat (17), Sheep (4), Chicken (1) |
| Reactivities | Human (32), Rabbit (15), Cow (Bovine) (7), Pig (Porcine) (4), Mouse (Murine) (3), Rat (Rattus) (3), Sheep (Ovine) (1) |
| Applications | Western Blotting (WB) (61), Enzyme Immunoassay (EIA) (26), ELISA (25), Immunofluorescence (IF) (25), Immunoprecipitation (IP) (18), Dot Blot (Dot) (12), Immunodiffusion (ID) (12), Radioimmunoassay (RIA) (12), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (9), ELISA (Detection) (3), Immunohistochemistry (IHC) (2), Flow Cytometry (FACS) (1), Immunocytochemistry (ICC) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1) |
| Conjugates | Biotin (8), HRP (4) |
