RPRD1B antibody (Middle Region)
-
- Target See all RPRD1B Antibodies
- RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPRD1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPRD1 B antibody was raised against the middle region of RPRD1
- Purification
- Affinity purified
- Immunogen
- RPRD1 B antibody was raised using the middle region of RPRD1 corresponding to a region with amino acids KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS
- Top Product
- Discover our top product RPRD1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPRD1B Blocking Peptide, catalog no. 33R-4494, is also available for use as a blocking control in assays to test for specificity of this RPRD1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPRD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))
- Alternative Name
- RPRD1B (RPRD1B Products)
- Synonyms
- fb23h08 antibody, zgc:55687 antibody, wu:fb23h08 antibody, rprd1ba antibody, MGC130705 antibody, C13H20ORF77 antibody, C20orf77 antibody, CREPT antibody, NET60 antibody, dJ1057B20.2 antibody, 2610304G08Rik antibody, 2810446G03Rik antibody, Crept antibody, RGD1304782 antibody, regulation of nuclear pre-mRNA domain containing 1B antibody, regulation of nuclear pre-mRNA domain containing 1B L homeolog antibody, rprd1b antibody, rprd1b.L antibody, RPRD1B antibody, Rprd1b antibody
- Background
- The function of RPRD1B protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 37 kDa (MW of target protein)
-