DUS1L antibody

Catalog No. ABIN632586

Product Details anti-DUS1L Antibody

Target: DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DUS1L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DUS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DUS1L Blocking Peptide, catalog no. 33R-4595, is also available for use as a blocking control in assays to test for specificity of this DUS1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DUS1L

Target: DUS1L (Dihydrouridine Synthase 1-Like (DUS1L))

Alternative Name: DUS1L (DUS1L Products)

Synonyms: zgc:63748 antibody, wu:fb71f06 antibody, DUS1 antibody, PP3111 antibody, 1110032N12Rik antibody, Dus1l antibody, x85 antibody, dihydrouridine synthase 1-like (S. cerevisiae) antibody, dihydrouridine synthase 1 like antibody, tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like antibody, dihydrouridine synthase 1-like (S. cerevisiae) pseudogene antibody, dihydrouridine synthase 1-like antibody, dus1l antibody, DUS1L antibody, LOC745178 antibody, LOC100408764 antibody, Dus1l antibody

Background: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Molecular Weight: 53 kDa (MW of target protein)