DHFRL1 antibody (Middle Region)

Catalog No. ABIN632654

Product Details anti-DHFRL1 Antibody

Target: DHFRL1 (Dihydrofolate Reductase-Like 1 (DHFRL1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHFRL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DHFRL1 antibody was raised against the middle region of DHFRL1

Purification: Affinity purified

Immunogen: DHFRL1 antibody was raised using the middle region of DHFRL1 corresponding to a region with amino acids RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHFRL1 Blocking Peptide, catalog no. 33R-7973, is also available for use as a blocking control in assays to test for specificity of this DHFRL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHFRL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHFRL1

Target: DHFRL1 (Dihydrofolate Reductase-Like 1 (DHFRL1))

Alternative Name: DHFRL1 (DHFRL1 Products)

Synonyms: DHFRP4 antibody, dihydrofolate reductase 2 antibody, DHFR2 antibody

Background: DHFRL1 may play a role in folate metabolism.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process