DCMP Deaminase (DCTD) (Middle Region) antibody

Catalog No. ABIN632656

This Rabbit Polyclonal antibody specifically detects DCMP Deaminase in WB. It exhibits reactivity toward Human.

Quick Overview for DCMP Deaminase (DCTD) (Middle Region) antibody (ABIN632656)

Target: DCMP Deaminase (DCTD)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: DCTD antibody was raised against the middle region of DCTD

Purification: Affinity purified

Immunogen: DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCTD Blocking Peptide, (ABIN5613141), is also available for use as a blocking control in assays to test for specificity of this DCTD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCTD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: DCMP Deaminase (DCTD)

Alternative Name: DCTD

Background: The protein encoded by this gene catalyzes the deamination of dCMP to dUMP, the nucleotide substrate for thymidylate synthase. The encoded protein is allosterically activated by dCTP and inhibited by dTTP, and is found as a homohexamer. This protein uses zinc as a cofactor for its activity. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 21 kDa (MW of target protein)