GALM antibody
-
- Target See all GALM Antibodies
- GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GALM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK
- Top Product
- Discover our top product GALM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GALM Blocking Peptide, catalog no. 33R-9947, is also available for use as a blocking control in assays to test for specificity of this GALM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))
- Alternative Name
- GALM (GALM Products)
- Synonyms
- GALM antibody, A530057M15Rik antibody, AU015645 antibody, AU020959 antibody, MUT antibody, IBD1 antibody, galactose mutarotase antibody, galactose mutarotase (aldose 1-epimerase) antibody, Aldose-1-epimerase (Galactose mutarotase) antibody, galactose mutarotase (aldose 1-epimerase) L homeolog antibody, GALM antibody, galm antibody, galM antibody, galm.L antibody, Ping_2018 antibody, BRADO1815 antibody, BBta_2135 antibody, Spro_1290 antibody, PC1_1264 antibody, Dd586_1213 antibody, Kvar_3617 antibody, AOLE_14520 antibody, Entcl_3074 antibody, Pat9b_1148 antibody, Rahaq_3123 antibody, Ccan_05570 antibody, Galm antibody
- Background
- GALM is an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. It is expressed in the cytoplasm and has a preference for galactose. The protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.
- Molecular Weight
- 38 kDa (MW of target protein)
-