AMDHD1 antibody (N-Term)

Catalog No. ABIN632735

Product Details anti-AMDHD1 Antibody

Target: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AMDHD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AMDHD1 antibody was raised against the N terminal of AMDHD1

Purification: Affinity purified

Immunogen: AMDHD1 antibody was raised using the N terminal of AMDHD1 corresponding to a region with amino acids AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AMDHD1 Blocking Peptide, catalog no. 33R-1604, is also available for use as a blocking control in assays to test for specificity of this AMDHD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMDHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AMDHD1

Target: AMDHD1 (Amidohydrolase Domain Containing 1 (AMDHD1))

Alternative Name: AMDHD1 (AMDHD1 Products)

Synonyms: RGD1308879 antibody, 1300019J08Rik antibody, amidohydrolase domain containing 1 antibody, amidohydrolase domain containing 1 L homeolog antibody, si:ch73-71d17.1 antibody, Amdhd1 antibody, AMDHD1 antibody, amdhd1 antibody, amdhd1.L antibody, si:ch73-71d17.1 antibody

Background: The function of AMDHD protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 47 kDa (MW of target protein)