HEATR4 antibody (N-Term)

Catalog No. ABIN632853

Product Details anti-HEATR4 Antibody

Target: HEATR4 (HEAT Repeat Containing 4 (HEATR4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HEATR4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HEATR4 antibody was raised against the N terminal of HEATR4

Purification: Affinity purified

Immunogen: HEATR4 antibody was raised using the N terminal of HEATR4 corresponding to a region with amino acids VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HEATR4 Blocking Peptide, catalog no. 33R-9524, is also available for use as a blocking control in assays to test for specificity of this HEATR4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEATR4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HEATR4

Target: HEATR4 (HEAT Repeat Containing 4 (HEATR4))

Alternative Name: HEATR4 (HEATR4 Products)

Synonyms: HEAT repeat containing 4 antibody, HEATR4 antibody

Background: The function of the HEATR4 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 112 kDa (MW of target protein)