PEPD antibody (Middle Region)

Catalog No. ABIN632867

The Rabbit Polyclonal anti-PEPD antibody is suitable to detect PEPD in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for PEPD antibody (Middle Region) (ABIN632867)

Target: PEPD (Peptidase D (PEPD))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEPD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PEPD Antibody

Binding Specificity: Middle Region

Specificity: Peptidase D antibody was raised against the middle region of PEPD

Purification: Affinity purified

Immunogen: Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Peptidase D Blocking Peptide, (ABIN940350), is also available for use as a blocking control in assays to test for specificity of this Peptidase D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEPD

Target: PEPD (Peptidase D (PEPD))

Alternative Name: Peptidase D

Background: Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.

Molecular Weight: 54 kDa (MW of target protein)