C18orf32 antibody (Middle Region)

Catalog No. ABIN632881

Product Details anti-C18orf32 Antibody

Target: C18orf32 (Chromosome 18 Open Reading Frame 32 (C18orf32))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C18orf32 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C18 ORF32 antibody was raised against the middle region of C18 rf32

Purification: Affinity purified

Immunogen: C18 ORF32 antibody was raised using the middle region of C18 rf32 corresponding to a region with amino acids PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C18ORF32 Blocking Peptide, catalog no. 33R-7213, is also available for use as a blocking control in assays to test for specificity of this C18ORF32 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C18orf32

Target: C18orf32 (Chromosome 18 Open Reading Frame 32 (C18orf32))

Alternative Name: C18ORF32 (C18orf32 Products)

Synonyms: chromosome 18 open reading frame 32 antibody, chromosome Z open reading frame, human C18orf32 antibody, C18orf32 antibody, CZH18ORF32 antibody, c18orf32 antibody

Background: The C18ORF32 protein may activate the NF-kappa-B signaling pathway.

Molecular Weight: 9 kDa (MW of target protein)