OAZ2 antibody (Middle Region)

Catalog No. ABIN632895

Product Details anti-OAZ2 Antibody

Target: OAZ2 (Ornithine Decarboxylase Antizyme 2 (OAZ2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OAZ2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OAZ2 antibody was raised against the middle region of OAZ2

Purification: Affinity purified

Immunogen: OAZ2 antibody was raised using the middle region of OAZ2 corresponding to a region with amino acids PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OAZ2 Blocking Peptide, catalog no. 33R-7012, is also available for use as a blocking control in assays to test for specificity of this OAZ2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAZ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OAZ2

Target: OAZ2 (Ornithine Decarboxylase Antizyme 2 (OAZ2))

Alternative Name: OAZ2 (OAZ2 Products)

Synonyms: AZ2 antibody, AZ-2 antibody, Oaz2-ps antibody, Sez15 antibody, AZL antibody, oaz2 antibody, wu:fa14f04 antibody, zgc:63816 antibody, RGD1562933 antibody, si:dkey-275p19.6 antibody, ornithine decarboxylase antizyme 2 antibody, ornithine decarboxylase antizyme 1b antibody, ornithine decarboxylase antizyme 2 S homeolog antibody, ornithine decarboxylase antizyme 2a antibody, OAZ2 antibody, Oaz2 antibody, oaz1b antibody, oaz2.S antibody, Tsp_12111 antibody, oaz2 antibody, oaz2a antibody

Background: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis.

Molecular Weight: 21 kDa (MW of target protein)