CXorf26 antibody (Middle Region)

Catalog No. ABIN632923

Product Details anti-CXorf26 Antibody

Target: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CXorf26 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CXORF26 antibody was raised against the middle region of Cxorf26

Purification: Affinity purified

Immunogen: CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CXORF26 Blocking Peptide, catalog no. 33R-4226, is also available for use as a blocking control in assays to test for specificity of this CXORF26 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF26 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CXorf26

Target: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Alternative Name: CXORF26 (CXorf26 Products)

Synonyms: CXorf26 antibody, MGC86379 antibody, CXHXorf26 antibody, 2610029G23Rik antibody, cb679 antibody, fc12c03 antibody, sb:cb679 antibody, wu:fc12c03 antibody, zgc:92611 antibody, RGD1562502 antibody, polysaccharide biosynthesis domain containing 1 antibody, polysaccharide biosynthesis domain containing 1 S homeolog antibody, PBDC1 antibody, pbdc1.S antibody, pbdc1 antibody, Pbdc1 antibody

Background: The function of Chromosome X ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 26 kDa (MW of target protein)