TASP1 antibody (Middle Region)
-
- Target See all TASP1 Antibodies
- TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TASP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TASP1 antibody was raised against the middle region of TASP1
- Purification
- Affinity purified
- Immunogen
- TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI
- Top Product
- Discover our top product TASP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TASP1 Blocking Peptide, catalog no. 33R-7663, is also available for use as a blocking control in assays to test for specificity of this TASP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TASP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))
- Alternative Name
- TASP1 (TASP1 Products)
- Synonyms
- 4930485D02Rik antibody, AW986064 antibody, RGD1308591 antibody, C20orf13 antibody, dJ585I14.2 antibody, taspase, threonine aspartase 1 antibody, taspase 1 antibody, Tasp1 antibody, TASP1 antibody
- Background
- This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits.
- Molecular Weight
- 19 kDa (MW of target protein)
-