TBC1D13 antibody (Middle Region)

Catalog No. ABIN632962

Product Details anti-TBC1D13 Antibody

Target: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBC1D13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBC1 D13 antibody was raised against the middle region of TBC1 13

Purification: Affinity purified

Immunogen: TBC1 D13 antibody was raised using the middle region of TBC1 13 corresponding to a region with amino acids FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBC1D13 Blocking Peptide, catalog no. 33R-2969, is also available for use as a blocking control in assays to test for specificity of this TBC1D13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBC1D13

Target: TBC1D13 (TBC1 Domain Family, Member 13 (TBC1D13))

Alternative Name: TBC1D13 (TBC1D13 Products)

Synonyms: 2600014A06Rik antibody, BC025586 antibody, TBC1 domain family member 13 antibody, TBC1 domain family, member 13 antibody, TBC1D13 antibody, Tbc1d13 antibody

Background: TBC1D13 may act as a GTPase-activating protein for Rab family proteins.

Molecular Weight: 44 kDa (MW of target protein)