PCGF1 antibody (Middle Region)

Catalog No. ABIN633027

Product Details anti-PCGF1 Antibody

Target: PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCGF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCGF1 antibody was raised against the middle region of PCGF1

Purification: Affinity purified

Immunogen: PCGF1 antibody was raised using the middle region of PCGF1 corresponding to a region with amino acids PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCGF1 Blocking Peptide, catalog no. 33R-6967, is also available for use as a blocking control in assays to test for specificity of this PCGF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCGF1

Target: PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))

Alternative Name: PCGF1 (PCGF1 Products)

Synonyms: PCGF1 antibody, 2010002K04Rik antibody, NSPC1 antibody, RNF3A-2 antibody, RNF68 antibody, AU024121 antibody, Nspc1 antibody, nspc1 antibody, si:zc207o21.2 antibody, polycomb group ring finger 1 antibody, polycomb group ring finger 1 L homeolog antibody, PCGF1 antibody, pcgf1 antibody, Pcgf1 antibody, pcgf1.L antibody

Background: PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.

Molecular Weight: 30 kDa (MW of target protein)