LRRC3 antibody (Middle Region)

Catalog No. ABIN633029

Product Details anti-LRRC3 Antibody

Target: LRRC3 (Leucine Rich Repeat Containing 3 (LRRC3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC3 antibody was raised against the middle region of LRRC3

Purification: Affinity purified

Immunogen: LRRC3 antibody was raised using the middle region of LRRC3 corresponding to a region with amino acids TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC3 Blocking Peptide, catalog no. 33R-9059, is also available for use as a blocking control in assays to test for specificity of this LRRC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC3

Target: LRRC3 (Leucine Rich Repeat Containing 3 (LRRC3))

Alternative Name: LRRC3 (LRRC3 Products)

Synonyms: C21orf102 antibody, 1300011L04Rik antibody, leucine rich repeat containing 3 antibody, LRRC3 antibody, Lrrc3 antibody

Background: The function of LRRC3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 25 kDa (MW of target protein)