ATPAF1 antibody (N-Term)

Catalog No. ABIN633038

Product Details anti-ATPAF1 Antibody

Target: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATPAF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATPAF1 antibody was raised against the N terminal of ATPAF1

Purification: Affinity purified

Immunogen: ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATPAF1 Blocking Peptide, catalog no. 33R-3393, is also available for use as a blocking control in assays to test for specificity of this ATPAF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPAF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATPAF1

Target: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Alternative Name: ATPAF1 (ATPAF1 Products)

Synonyms: ATPAF1 antibody, T14G11.17 antibody, T14G11_17 antibody, ATP11 antibody, ATP11p antibody, 6330547J17Rik antibody, AI593252 antibody, id:ibd1136 antibody, si:dkey-171o17.2 antibody, zgc:110583 antibody, ATP synthase mitochondrial F1 complex assembly factor 1 antibody, ATP synthase F1 complex assembly factor antibody, Atpaf1 antibody, ATPAF1 antibody, AT2G34050 antibody, atpaf1 antibody

Background: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Molecular Weight: 29 kDa (MW of target protein)