AS3MT antibody

Catalog No. ABIN633047

Product Details anti-AS3MT Antibody

Target: AS3MT (Arsenic (+3 Oxidation State) Methyltransferase (AS3MT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AS3MT antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AS3 MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AS3MT Blocking Peptide, catalog no. 33R-3331, is also available for use as a blocking control in assays to test for specificity of this AS3MT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AS0 T antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AS3MT

Target: AS3MT (Arsenic (+3 Oxidation State) Methyltransferase (AS3MT))

Alternative Name: AS3MT (AS3MT Products)

Synonyms: CYT19 antibody, 2310045H08Rik antibody, Cyt19 antibody, AS3MT antibody, zgc:136933 antibody, DKFZp469A1918 antibody, cyt19 antibody, arsenite methyltransferase antibody, arsenic (+3 oxidation state) methyltransferase antibody, BLOC-1 related complex subunit 7 antibody, arsenite methyltransferase, gene 1 antibody, AS3MT antibody, As3mt antibody, as3mt antibody, BORCS7 antibody, as3mt.1 antibody, ABO_2182 antibody

Background: AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism.

Molecular Weight: 42 kDa (MW of target protein)