HLA-DQA2 antibody (Middle Region)

Catalog No. ABIN633062

The Rabbit Polyclonal anti-HLA-DQA2 antibody is suitable to detect HLA-DQA2 in samples from Human. It has been validated for WB.

Quick Overview for HLA-DQA2 antibody (Middle Region) (ABIN633062)

Target: HLA-DQA2 (Major Histocompatibility Complex, Class II, DQ alpha 2 (HLA-DQA2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HLA-DQA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HLA-DQA2 Antibody

Binding Specificity: Middle Region

Specificity: HLA-DQA2 antibody was raised against the middle region of HLA-DQA2

Purification: Affinity purified

Immunogen: HLA-DQA2 antibody was raised using the middle region of HLA-DQA2 corresponding to a region with amino acids LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HLA-DQA2 Blocking Peptide, (ABIN5614020), is also available for use as a blocking control in assays to test for specificity of this HLA-DQA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DQA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HLA-DQA2

Target: HLA-DQA2 (Major Histocompatibility Complex, Class II, DQ alpha 2 (HLA-DQA2))

Alternative Name: HLA-DQA2

Background: This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognised by CD4 T-cells.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: TCR Signaling, Human Leukocyte Antigen (HLA) in Adaptive Immune Response