DNAJA2 antibody

Catalog No. ABIN633071

The Rabbit Polyclonal anti-DNAJA2 antibody is suitable to detect DNAJA2 in samples from Human. It has been validated for WB.

Quick Overview for DNAJA2 antibody (ABIN633071)

Target: DNAJA2 (DnaJ (Hsp40) Homolog, Subfamily A, Member 2 (DNAJA2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNAJA2 Antibody

Purification: Affinity purified

Immunogen: DNAJA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJA2 Blocking Peptide, (ABIN936091), is also available for use as a blocking control in assays to test for specificity of this DNAJA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJA2

Target: DNAJA2 (DnaJ (Hsp40) Homolog, Subfamily A, Member 2 (DNAJA2))

Alternative Name: DNAJA2

Background: The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro.

Molecular Weight: 46 kDa (MW of target protein)