DnaJ (Hsp40) Homolog, Subfamily A, Member 2 (DNAJA2) antibody

Antigen: DnaJ (Hsp40) Homolog, Subfamily A, Member 2 (DNAJA2)

Synonyms: DJ3, CPR3, DJA2, DNAJ, DNJ3, RDJ2, HIRIP4, PRO3015, mDj3, Dnaj3, 1500017M13Rik, 2010206B19Rik, dj3, cpr3, dja2, dnaj, dnj3, rdj2, hirip4, MGC53478, dnaja2, DNAJA2

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN633071

Additional Information

Alternative name: DNAJA2

Immunogen: DNAJA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGM

Description: The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro.

Molecular Weight: 46 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNAJA2 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Signaling, Heat Shock Proteins