EIF4A1 antibody (Middle Region)

Catalog No. ABIN633087

Product Details anti-EIF4A1 Antibody

Target: EIF4A1 (Eukaryotic Translation Initiation Factor 4A1 (EIF4A1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF4 A1 antibody was raised against the middle region of EIF4 1

Purification: Affinity purified

Immunogen: EIF4 A1 antibody was raised using the middle region of EIF4 1 corresponding to a region with amino acids TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF4A1 Blocking Peptide, catalog no. 33R-9207, is also available for use as a blocking control in assays to test for specificity of this EIF4A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4A1

Target: EIF4A1 (Eukaryotic Translation Initiation Factor 4A1 (EIF4A1))

Alternative Name: EIF4A1 (EIF4A1 Products)

Synonyms: DDX2A antibody, EIF-4A antibody, EIF4A antibody, eIF-4A-I antibody, eIF4A-I antibody, BM-010 antibody, Ddx2a antibody, Eif4 antibody, ddx2a antibody, eif-4a antibody, eif4a antibody, eif4a1 antibody, fb49a04 antibody, im:7143023 antibody, wu:fb20a10 antibody, wu:fb49a04 antibody, wu:fc76a02 antibody, wu:fc96c01 antibody, wu:fd15g03 antibody, eukaryotic translation initiation factor 4A1 antibody, eukaryotic translation initiation factor 4A1 L homeolog antibody, eukaryotic initiation factor 4A-I antibody, eukaryotic translation initiation factor 4A1A antibody, EIF4A1 antibody, Eif4a1 antibody, eif4a1.L antibody, eif4a1 antibody, LOC695050 antibody, eif4a1a antibody

Background: EIF4A1 is an ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Molecular Weight: 46 kDa (MW of target protein)