Neuronatin (NNAT) (Middle Region) antibody

Catalog No. ABIN633088

Product Details

Target: Neuronatin (NNAT)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Specificity: NNAT antibody was raised against the middle region of NNAT

Purification: Affinity purified

Immunogen: NNAT antibody was raised using the middle region of NNAT corresponding to a region with amino acids MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NNAT Blocking Peptide, catalog no. 33R-5614, is also available for use as a blocking control in assays to test for specificity of this NNAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Neuronatin (NNAT)

Alternative Name: NNAT (NNAT Products)

Synonyms: Peg5 antibody, 5730414I02Rik antibody, AW107673 antibody, neuronatin antibody, NNAT antibody, Nnat antibody

Background: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.

Molecular Weight: 6 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion