CFDP1 antibody (Middle Region)

Catalog No. ABIN633098

Product Details anti-CFDP1 Antibody

Target: CFDP1 (Craniofacial Development Protein 1 (CFDP1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CFDP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CFDP1 antibody was raised against the middle region of CFDP1

Purification: Affinity purified

Immunogen: CFDP1 antibody was raised using the middle region of CFDP1 corresponding to a region with amino acids GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CFDP1 Blocking Peptide, catalog no. 33R-3561, is also available for use as a blocking control in assays to test for specificity of this CFDP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFDP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CFDP1

Target: CFDP1 (Craniofacial Development Protein 1 (CFDP1))

Alternative Name: CFDP1 (CFDP1 Products)

Synonyms: CFDP1 antibody, cfdp1 antibody, fi15f05 antibody, MGC136405 antibody, wu:fi15f05 antibody, zgc:136405 antibody, BCNT antibody, BUCENTAUR antibody, CENP-29 antibody, CP27 antibody, SWC5 antibody, Yeti antibody, p97 antibody, AA408409 antibody, Bcnt antibody, Bucentaur antibody, Cfdp antibody, cp27 antibody, bcnt antibody, P97 antibody, craniofacial development protein 1 antibody, CFDP1 antibody, cfdp1 antibody, CpipJ_CPIJ018830 antibody, LOC100282347 antibody, Cfdp1 antibody

Background: CFDP1 may play a role during embryogenesis.

Molecular Weight: 33 kDa (MW of target protein)