SKIV2L antibody

Catalog No. ABIN633197

Product Details anti-SKIV2L Antibody

Target: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SKIV2L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SKIV2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SKIV2L Blocking Peptide, catalog no. 33R-8835, is also available for use as a blocking control in assays to test for specificity of this SKIV2L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKIV0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SKIV2L

Target: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Alternative Name: SKIV2L (SKIV2L Products)

Synonyms: 4930534J06Rik antibody, AW214248 antibody, Ddx13 antibody, SKI antibody, Ski2w antibody, 170A antibody, DDX13 antibody, HLP antibody, SKI2 antibody, SKI2W antibody, SKIV2 antibody, THES2 antibody, superkiller viralicidic activity 2-like (S. cerevisiae) antibody, Ski2 like RNA helicase antibody, Skiv2l antibody, SKIV2L antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure.

Molecular Weight: 138 kDa (MW of target protein)