HNRNPL antibody (N-Term)

Catalog No. ABIN633254

The Rabbit Polyclonal anti-HNRNPL antibody is suitable to detect HNRNPL in samples from Human, Mouse, Rat and Dog. It has been validated for WB and IHC.

Quick Overview for HNRNPL antibody (N-Term) (ABIN633254)

Target: HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPL antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-HNRNPL Antibody

Binding Specificity: N-Term

Specificity: HNRPL antibody was raised against the N terminal of HNRPL

Purification: Affinity purified

Immunogen: HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPL Blocking Peptide, (ABIN936182), is also available for use as a blocking control in assays to test for specificity of this HNRPL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPL

Target: HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))

Alternative Name: HNRPL

Background: Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.

Molecular Weight: 65 kDa (MW of target protein)