Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1) antibody

Antigen

Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1)

Synonyms Gababrbp, Marlin-1, 5830437M04Rik, C330021K24Rik, JAMIP1, MARLIN1, FLJ31564, MGC125191, MGC125215, MGC81051, MGC166311
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN633295
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name JAKMIP1
Immunogen JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE
Description JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.
Molecular Weight 97 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAKMIP1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1)", type "Antibodies"
Hosts Rabbit (2)
Reactivities Human (2)
Applications Western Blotting (WB) (2), ELISA (1), Enzyme Immunoassay (EIA) (1), Immunohistochemistry (IHC) (1)
Epitopes Center (1)