AGFG1 antibody (Middle Region)

Catalog No. ABIN633314

Product Details anti-AGFG1 Antibody

Target: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGFG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HRB antibody was raised against the middle region of HRB

Purification: Affinity purified

Immunogen: HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HRB Blocking Peptide, catalog no. 33R-8725, is also available for use as a blocking control in assays to test for specificity of this HRB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGFG1

Target: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Alternative Name: HRB (HRB Products)

Synonyms: HRB antibody, RAB antibody, RIP antibody, AU045498 antibody, C130049H11Rik antibody, C85612 antibody, D730048C23Rik antibody, Hrb antibody, Rip antibody, hrb antibody, agfg1 antibody, wu:fb14f05 antibody, wu:fi19d11 antibody, MGC83726 antibody, MGC97591 antibody, ArfGAP with FG repeats 1 antibody, ArfGAP with FG repeats 1a antibody, ArfGAP with FG repeats 1 S homeolog antibody, KRR1 small subunit processome component homolog antibody, AGFG1 antibody, Agfg1 antibody, agfg1a antibody, agfg1.S antibody, agfg1 antibody, LOC5565923 antibody

Background: HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.

Molecular Weight: 58 kDa (MW of target protein)