XRN1 antibody (Middle Region)

Catalog No. ABIN633318

Product Details anti-XRN1 Antibody

Target: XRN1 (5'-3' Exoribonuclease 1 (XRN1))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XRN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: XRN1 antibody was raised against the middle region of XRN1

Purification: Affinity purified

Immunogen: XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XRN1 Blocking Peptide, catalog no. 33R-5282, is also available for use as a blocking control in assays to test for specificity of this XRN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XRN1

Target: XRN1 (5'-3' Exoribonuclease 1 (XRN1))

Alternative Name: XRN1 (XRN1 Products)

Synonyms: wu:fk92c07 antibody, zgc:63635 antibody, SEP1 antibody, Dhm2 antibody, exo antibody, mXrn1 antibody, RGD1309713 antibody, 5'-3' exoribonuclease 1 antibody, xrn1 antibody, XRN1 antibody, Tsp_05930 antibody, Xrn1 antibody

Background: SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.

Molecular Weight: 194 kDa (MW of target protein)