AUH antibody (C-Term)

Catalog No. ABIN633391

Product Details anti-AUH Antibody

Target: AUH (AU RNA Binding Protein/enoyl-CoA Hydratase (AUH))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AUH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: AUH antibody was raised against the C terminal of AUH

Purification: Affinity purified

Immunogen: AUH antibody was raised using the C terminal of AUH corresponding to a region with amino acids IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AUH Blocking Peptide, catalog no. 33R-3974, is also available for use as a blocking control in assays to test for specificity of this AUH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AUH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AUH

Target: AUH (AU RNA Binding Protein/enoyl-CoA Hydratase (AUH))

Alternative Name: AUH (AUH Products)

Synonyms: C77140 antibody, W91705 antibody, wu:fb81b10 antibody, zgc:101057 antibody, AU RNA binding methylglutaconyl-CoA hydratase antibody, AU RNA binding protein/enoyl-coenzyme A hydratase antibody, AU RNA binding protein/enoyl-CoA hydratase antibody, AU RNA binding protein/enoyl-CoA hydratase S homeolog antibody, AUH antibody, Auh antibody, auh antibody, auh.S antibody

Background: AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity.

Molecular Weight: 37 kDa (MW of target protein)