HNRPLL antibody (N-Term)
-
- Target See all HNRPLL Antibodies
- HNRPLL (Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HNRPLL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HNRPLL antibody was raised against the N terminal of HNRPLL
- Purification
- Affinity purified
- Immunogen
- HNRPLL antibody was raised using the N terminal of HNRPLL corresponding to a region with amino acids MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG
- Top Product
- Discover our top product HNRPLL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HNRPLL Blocking Peptide, catalog no. 33R-6514, is also available for use as a blocking control in assays to test for specificity of this HNRPLL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPLL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRPLL (Heterogeneous Nuclear Ribonucleoprotein L-Like (HNRPLL))
- Alternative Name
- HNRPLL (HNRPLL Products)
- Synonyms
- HNRPLL antibody, SRRF antibody, 2510028H02Rik antibody, 2810036L13Rik antibody, AI256697 antibody, AI852082 antibody, Hnrpll antibody, RGD1305861 antibody, srrf antibody, heterogeneous nuclear ribonucleoprotein L like antibody, heterogeneous nuclear ribonucleoprotein L-like antibody, Heterogeneous nuclear ribonucleoprotein L-like antibody, heterogeneous nuclear ribonucleoprotein L antibody, HNRNPLL antibody, Hnrnpll antibody, HNRPLL antibody, hnrnpll antibody, LOC100160547 antibody, hnrll antibody, LOC100542006 antibody, LOC100638467 antibody, LOC100647365 antibody, HNRNPL antibody
- Background
- HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing.
- Molecular Weight
- 60 kDa (MW of target protein)
-