Synaptojanin 2 antibody (N-Term)

Catalog No. ABIN633514

Product Details anti-Synaptojanin 2 Antibody

Target: Synaptojanin 2 (SYNJ2)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Synaptojanin 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Synaptojanin 2 antibody was raised against the N terminal of SYNJ2

Purification: Affinity purified

Immunogen: Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Synaptojanin 2 Blocking Peptide, catalog no. 33R-8466, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Synaptojanin 2

Target: Synaptojanin 2 (SYNJ2)

Alternative Name: Synaptojanin 2 (SYNJ2 Products)

Synonyms: SYNJ2 antibody, INPP5H antibody, AI481647 antibody, SJ2 antibody, mKIAA0348 antibody, synaptojanin 2 antibody, synaptojanin-2 antibody, SYNJ2 antibody, LOC100074269 antibody, synj2 antibody, Synj2 antibody

Background: SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function.

Molecular Weight: 165 kDa (MW of target protein)

Pathways: Inositol Metabolic Process