FAM71D antibody (Middle Region)

Catalog No. ABIN633553

Product Details anti-FAM71D Antibody

Target: FAM71D (Family with Sequence Similarity 71, Member D (FAM71D))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM71D antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM71 D antibody was raised against the middle region of FAM71

Purification: Affinity purified

Immunogen: FAM71 D antibody was raised using the middle region of FAM71 corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM71D Blocking Peptide, catalog no. 33R-9860, is also available for use as a blocking control in assays to test for specificity of this FAM71D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM71D

Target: FAM71D (Family with Sequence Similarity 71, Member D (FAM71D))

Alternative Name: FAM71D (FAM71D Products)

Synonyms: GARI-L2 antibody, 4921509E07Rik antibody, 4930516C23Rik antibody, C14orf54 antibody, C10H14orf54 antibody, family with sequence similarity 71, member D antibody, family with sequence similarity 71 member D antibody, Fam71d antibody, FAM71D antibody

Background: The function of FAM71 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 46 kDa (MW of target protein)