TRPC6 antibody (N-Term)

Catalog No. ABIN633748

This Rabbit Polyclonal antibody specifically detects TRPC6 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TRPC6 antibody (N-Term) (ABIN633748)

Target: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRPC6 Antibody

Binding Specificity: N-Term

Specificity: TRPC6 antibody was raised against the N terminal of TRPC6

Purification: Affinity purified

Immunogen: TRPC6 antibody was raised using the N terminal of TRPC6 corresponding to a region with amino acids MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPC6 Blocking Peptide, (ABIN5616812), is also available for use as a blocking control in assays to test for specificity of this TRPC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPC6

Target: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Alternative Name: TRPC6

Background: TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

Molecular Weight: 106 kDa (MW of target protein)