PHGDH antibody (Middle Region)

Catalog No. ABIN633828

The Rabbit Polyclonal anti-PHGDH antibody (ABIN633828) specifically detects PHGDH in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for PHGDH antibody (Middle Region) (ABIN633828)

Target: PHGDH (phosphoglycerate Dehydrogenase (PHGDH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHGDH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PHGDH Antibody

Binding Specificity: Middle Region

Specificity: PHGDH antibody was raised against the middle region of PHGDH

Purification: Affinity purified

Immunogen: PHGDH antibody was raised using the middle region of PHGDH corresponding to a region with amino acids CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHGDH Blocking Peptide, (ABIN937027), is also available for use as a blocking control in assays to test for specificity of this PHGDH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHGDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHGDH

Target: PHGDH (phosphoglycerate Dehydrogenase (PHGDH))

Alternative Name: PHGDH

Background: 3-Phosphoglycerate dehydrogenase (PHGDH) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.3-Phosphoglycerate dehydrogenase (PHGDH, EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Warburg Effect