Neuroserpin antibody

Catalog No. ABIN633836

The Rabbit Polyclonal anti-Neuroserpin antibody is suitable to detect Neuroserpin in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Neuroserpin antibody (ABIN633836)

Target: Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Neuroserpin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Neuroserpin Antibody

Purification: Affinity purified

Immunogen: SERPINI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINI1 Blocking Peptide, (ABIN936726), is also available for use as a blocking control in assays to test for specificity of this SERPINI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Neuroserpin

Target: Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))

Alternative Name: SERPINI1

Background: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process