OPTC antibody (C-Term)

Catalog No. ABIN633856

Product Details anti-OPTC Antibody

Target: OPTC (Opticin (OPTC))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OPTC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Opticin antibody was raised against the C terminal of OPTC

Purification: Affinity purified

Immunogen: Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Opticin Blocking Peptide, catalog no. 33R-5414, is also available for use as a blocking control in assays to test for specificity of this Opticin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OPTC

Target: OPTC (Opticin (OPTC))

Alternative Name: Opticin (OPTC Products)

Synonyms: OPTC antibody, optc antibody, OPT antibody, SLRP antibody, dspg3 antibody, optcl antibody, wu:fb81a05 antibody, zgc:101047 antibody, opticin antibody, OPTC antibody, optc antibody, Optc antibody

Background: Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also ocalizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization.

Molecular Weight: 35 kDa (MW of target protein)