Fibulin 1 antibody (N-Term)
-
- Target See all Fibulin 1 (FBLN1) Antibodies
- Fibulin 1 (FBLN1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Fibulin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FBLN1 antibody was raised against the N terminal of FBLN1
- Purification
- Affinity purified
- Immunogen
- FBLN1 antibody was raised using the N terminal of FBLN1 corresponding to a region with amino acids CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD
- Top Product
- Discover our top product FBLN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FBLN1 Blocking Peptide, catalog no. 33R-1657, is also available for use as a blocking control in assays to test for specificity of this FBLN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBLN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fibulin 1 (FBLN1)
- Alternative Name
- FBLN1 (FBLN1 Products)
- Synonyms
- fbln1 antibody, FBLN antibody, FIBL1 antibody, fbln1c antibody, fbln1d antibody, wu:fc52c06 antibody, MGC115035 antibody, fibulin 1 antibody, fibulin 1 L homeolog antibody, FBLN1 antibody, fbln1 antibody, Fbln1 antibody, fbln1.L antibody, CpipJ_CPIJ017419 antibody
- Background
- Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen.
- Molecular Weight
- 72 kDa (MW of target protein)
-