CHI3L1 antibody

Catalog No. ABIN633931

This Rabbit Polyclonal antibody specifically detects CHI3L1 in WB. It exhibits reactivity toward Human.

Quick Overview for CHI3L1 antibody (ABIN633931)

Target: CHI3L1 (Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHI3L1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHI3L1 Antibody

Purification: Affinity purified

Immunogen: CHI3 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHI3L1 Blocking Peptide, (ABIN940230), is also available for use as a blocking control in assays to test for specificity of this CHI3L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHI0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHI3L1

Target: CHI3L1 (Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1))

Alternative Name: CHI3L1

Background: CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.

Molecular Weight: 42 kDa (MW of target protein)