Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL) antibody

Antigen

3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL)

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN633970
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name HMGCL
Immunogen HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL
Description The HMGCL protein belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes the final step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associated with HMG-CoA lyase deficiency.
Molecular Weight 36 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HMGCL antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Cancer, Metabolism, Amino Acids

Alternatives

Alternatives for antigen "3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL)", type "Antibodies"
Hosts Rabbit (9), Mouse (3)
Reactivities Human (11), Mouse (Murine) (5), Rat (Rattus) (5)
Applications Western Blotting (WB) (6), Flow Cytometry (FACS) (5), Immunofluorescence (IF) (5), Enzyme Immunoassay (EIA) (2), ELISA (1), ELISA (Detection) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), PE,Cy5.5 (1)