CTRP7 antibody (Middle Region)

Catalog No. ABIN634045

This Rabbit Polyclonal antibody specifically detects CTRP7 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CTRP7 antibody (Middle Region) (ABIN634045)

Target: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTRP7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CTRP7 Antibody

Binding Specificity: Middle Region

Specificity: C1 QTNF7 antibody was raised against the middle region of C1 TNF7

Purification: Affinity purified

Immunogen: C1 QTNF7 antibody was raised using the middle region of C1 TNF7 corresponding to a region with amino acids SIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1QTNF7 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this C1QTNF7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTRP7

Target: CTRP7 (C1QTNF7) (C1q and Tumor Necrosis Factor Related Protein 7 (C1QTNF7))

Alternative Name: C1QTNF7

Background: The specific function of C1QTNF7 is not yet known.

Molecular Weight: 31 kDa (MW of target protein)